PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29949.m000124
Common NameRCOM_1120410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 582aa    MW: 65343.7 Da    PI: 6.7466
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29949.m000124genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.81.2e-1251775051331
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l+++L++cA+avs++dl +aq+l+ +l++++s +g+p+qRl ay++e+L arla+s+s++yk+l+++e +   s++ l+++++++ev+P++kf+++
  29949.m000124 177 LKHVLIACAKAVSDNDLLMAQWLMDELRQIVSVSGEPIQRLGAYMLEGLVARLASSGSSIYKSLRCKEPA---SADLLSYMHILYEVCPYFKFGYM 269
                    689******************************************************************9...9********************** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI ea++ e++vHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +    + +g+rLak+Ae+++vpfef++ +a   ++++
  29949.m000124 270 SANGAIAEAMKDENKVHIIDFQIGQGSQWVTLIQAFAARPGGPPRIRITGIDDSTSAyaRGGGPNIVGKRLAKLAESVKVPFEFHA-AAMPNSEVH 364
                    *****************************************************99888888999**********************.89999**** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +++L v+pgEalaVn++++lh+l+desvs++++rd++L+lvkslsPkvv++veqe+++n++ F+ rfle+l+yy+a+f+s++++l+re++eri+vE
  29949.m000124 365 IKNLGVEPGEALAVNFAFMLHHLPDESVSTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFFPRFLETLNYYTAMFESIDVTLSREHKERINVE 460
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                    +++l+r++vn++aceg+er+erhe l+kWr+r+++aGF+p+pls+
  29949.m000124 461 QHCLARDVVNIIACEGTERVERHELLGKWRSRFRMAGFTPYPLSS 505
                    *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.635151528IPR005202Transcription factor GRAS
PfamPF035144.3E-123177505IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MQSSQQYRSR CMSSKLYNQP MQEFEAYCMP QFQTLDHQLR YNGSSQRTHL SIPNARDQYC  60
TLESSSANGS YPIYNSPSTV SLSPNGSPVS QQESQSYPPD LHHSPDNNYG SPISGSCITD  120
DVNDFRSKLR ELETDLLGPD YGFMESIESN FQNGSSIKSP EMDIWRQMME AISRGDLKHV  180
LIACAKAVSD NDLLMAQWLM DELRQIVSVS GEPIQRLGAY MLEGLVARLA SSGSSIYKSL  240
RCKEPASADL LSYMHILYEV CPYFKFGYMS ANGAIAEAMK DENKVHIIDF QIGQGSQWVT  300
LIQAFAARPG GPPRIRITGI DDSTSAYARG GGPNIVGKRL AKLAESVKVP FEFHAAAMPN  360
SEVHIKNLGV EPGEALAVNF AFMLHHLPDE SVSTQNHRDR LLRLVKSLSP KVVTLVEQES  420
NTNTAAFFPR FLETLNYYTA MFESIDVTLS REHKERINVE QHCLARDVVN IIACEGTERV  480
ERHELLGKWR SRFRMAGFTP YPLSSLRFGG ILCMEMKPWY LFTLVLELVQ GRVLCRVILL  540
ICGKMAICFE ATIAMALNLL LCLVYRENRL LVLLHGQNNS HS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-571815058330GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583656.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015583657.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015583658.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015583660.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015583661.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015583662.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLB9T6K10.0B9T6K1_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein